| Basic Information | |
|---|---|
| Taxon OID | 3300025880 Open in IMG/M |
| Scaffold ID | Ga0209534_10244236 Open in IMG/M |
| Source Dataset Name | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 863 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Helgoland, sampling site Kabeltonne | |||||||
| Coordinates | Lat. (o) | 54.184167 | Long. (o) | 7.9 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002093 | Metagenome / Metatranscriptome | 594 | Y |
| F099434 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209534_102442361 | F099434 | AGGAGG | MPITKNNFVHGTNMELEGVETSTFVVDFVNAMTNETSDLSSGSATAGLEATRAVISRYINILSEGPLHESDKQKTYTVRTDSLGTLISG |
| Ga0209534_102442362 | F002093 | AGGAGG | MAYDATLPAGGPGNFVSPNTAHEADGVEVDFITVDYISDVSGEVTNPRASAATGALELSMQAIQNQGVNILGKGVLSNSDTEQTYMVRRDSLDTISSTTTVAAIQAAVRALNALTPDKVTATISSATAADRDMGDTSVGA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |