| Basic Information | |
|---|---|
| Taxon OID | 3300025859 Open in IMG/M |
| Scaffold ID | Ga0209096_1046607 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1985 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA | |||||||
| Coordinates | Lat. (o) | 39.84 | Long. (o) | -89.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033445 | Metagenome / Metatranscriptome | 177 | N |
| F058173 | Metagenome / Metatranscriptome | 135 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209096_10466073 | F058173 | GGAGG | MTYWIVGGIVLAVIAVIAAYSYGRYHPDPDMVAQLTEQIRLETVKQYEQRINDLDKQLKISQTAYIESQKRYDNIITRLKEIKDAKNDIKPPQTASELTSRFTALGYTPVGQ |
| Ga0209096_10466074 | F033445 | N/A | MVVELEKGRLCEKQIIQYEDATRELTEQIGQLRIQVDAMNVKFDETVKQLEAERKIAEEKDKARLEEIKQAGKPQWMMLFGGFSAGAVLVVVGALILLL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |