NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208694_1025704

Scaffold Ga0208694_1025704


Overview

Basic Information
Taxon OID3300025737 Open in IMG/M
Scaffold IDGa0208694_1025704 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3204
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA
CoordinatesLat. (o)42.35Long. (o)-70.96Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021528Metagenome / Metatranscriptome218N
F069750Metagenome / Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
Ga0208694_10257045F069750GGAGMILSGEFPLQENSFFVEGAKFLIRERKKARGKKPQYYLVKLEPFQYVSSLFPTGEGECYTFDFEQKLYRLERKEHSVTLRFV
Ga0208694_10257049F021528N/AKVMLNDYWISSDSEIRVQPASYELGTGTKVEYPLFETPEQRFYGAKAYLNEDNWNLTLKPLAGGRAVGAFLQLSIPKNYYGNNFYSVGEQGTEAVLSKVEGELKERGVHTNLQEADISRVDTFKNIEPEEPFSSYYSLFSLLKARKAIQRGYGTTFLLSNTQQEFCVYDKLAEMRERQLETGNLPPTMRFEHRLLNKQKVQNVYGLSKVEDIFRGGYQVIREKQVESWKNSLFNFTAEEVVLLGSRQLEQEMRVFKEKFPSNWFSKFLKAYGAYYLASYAGKEVVIEALQAFEADRMKLWRAVQVFEEAEKELLVLKQEEGSSKTLGVLYEELRRKVCLN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.