NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208784_1095062

Scaffold Ga0208784_1095062


Overview

Basic Information
Taxon OID3300025732 Open in IMG/M
Scaffold IDGa0208784_1095062 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)894
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F007470Metagenome / Metatranscriptome350Y
F019321Metagenome / Metatranscriptome230Y

Sequences

Protein IDFamilyRBSSequence
Ga0208784_10950622F007470N/AMSQTTNRLDTQGDKMDYQDGFEDGVKFAREVITANIRLWAESEDDGQVYDDIADRIEFGTVDYDL
Ga0208784_10950623F000311GAGGMYFELTAPDRLSMEMAYWDAQIMGLDPMALTPLTFNIGTGSIEKVSRIRDKFNLKETYVSDYEPTGYTGR
Ga0208784_10950624F019321N/ARVGLLESNINTVKDIILEAYADSSDPDTLQAIAEALNIELTKDVEFTATIEVSGTITLNLLEDYDLESEITDSLYVDANNGNIQIDDTEVCHVREAY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.