NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208160_1018095

Scaffold Ga0208160_1018095


Overview

Basic Information
Taxon OID3300025647 Open in IMG/M
Scaffold IDGa0208160_1018095 Open in IMG/M
Source Dataset NameFreshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2266
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)38.8455Long. (o)-76.4191Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006971Metagenome / Metatranscriptome361Y
F039398Metagenome / Metatranscriptome164N
F054882Metagenome / Metatranscriptome139N

Sequences

Protein IDFamilyRBSSequence
Ga0208160_10180953F006971GGAMIYQGIEYKKHQKVKFVIPTDLRIVDPQTKKILWRYGIIHFFAKNTKSAWILENGTKESIKISLFCVLPVN
Ga0208160_10180954F039398GAGGMEYAADDINIGYMTCLMFINSEKTLVDKLNNITEIHPISLNGIFDNIKDTHQGGVSFDLVLKSLPTYVEITMNHNGNFNIYTKTFKGETEFKDEVVETLINFLHIFYVNMVDDENKLLLNAIDTTTYRKIAKRMHYREKFGNDLSGD
Ga0208160_10180957F054882N/AKDIYNKDLDMYDAETNIKAARWLSYYSGWHHWNSSKHCWGRYK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.