NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209136_1069936

Scaffold Ga0209136_1069936


Overview

Basic Information
Taxon OID3300025636 Open in IMG/M
Scaffold IDGa0209136_1069936 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1100
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036687Metagenome / Metatranscriptome169Y
F064404Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0209136_10699361F036687N/ALNTKMNYKPLVVILIFGLFHTNAQQKSDISFKEIESKFCRNCYGSLVVEKGSVSDTINGGQWGHPVNYELVQIKDKEYLNTNYRYGYPGGQAIMVYKIHSLDQDNFLVPVFEKSIEVYRETHRNYNNVPTNFIFDRTVDVRIKKGIEFEISLKISYCPEIEDEKCETLFEESHIDFYKIN
Ga0209136_10699362F064404N/AMIHFFGYFKVTNHIGISSVGFEKAAIFLRNRDFKVVELFGLKNNEEVNLLYENEEPVWITKDHHIHIHSLFEENEYSTFTHVKIELADGGDINYSAASLYVKFPDGEDIKSKTIMLLETMGYYAGEKIFDFCSENPDMHLLEFVLGMEPEDITDEFERMKSHTEYINNEEYLKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.