NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209136_1005611

Scaffold Ga0209136_1005611


Overview

Basic Information
Taxon OID3300025636 Open in IMG/M
Scaffold IDGa0209136_1005611 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6424
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (95.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015039Metagenome / Metatranscriptome258Y
F073416Metagenome / Metatranscriptome120Y
F073419Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0209136_10056112F073416AGGAMTDELQLIERLEGVRRIINQQPHLADVILLGMIEEAEQKIAQFEKTMQEDFFDNVPV
Ga0209136_100561120F073419GAGGMDNTYFEATPQQKQLATIGREMMNFSEEYGKIHGLKAVTDDGLRTLNNLSHVGNALTHFGATYGTTAKDFSDEDRVLISNFMQKKVDIERK
Ga0209136_10056119F015039GGAGGMDDEIDNTRRIYITVALEILRDANEQEVIAECDYTFEHADIVDTEIMGEDEHYA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.