NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209136_1004512

Scaffold Ga0209136_1004512


Overview

Basic Information
Taxon OID3300025636 Open in IMG/M
Scaffold IDGa0209136_1004512 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7436
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (87.50%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameSaanich Inlet, British Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015039Metagenome / Metatranscriptome258Y
F023086Metagenome / Metatranscriptome211Y
F041087Metagenome / Metatranscriptome160Y
F073419Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0209136_100451211F041087AGGAGMMDLWDEVIEQIENDLEDRDTTALYEMLQRVPKDVLIAYLPEGREFIVSDN
Ga0209136_10045122F023086AGGMQNTNTQYNTAVVAAIESFAKTIVNCAHDSVLENNDYAIYDSIDSIQFLYSNYTKYNCVNSLANAALDSNLDTLVRENIHAQLV
Ga0209136_100451222F073419GAGGMTQAFFEATQEQKQLATIGRQMMDYSEEYGKIHGLKAVTDDGLRTLNNLSHVGNALTHFGATWGTTAKDFSEEDRELIVQWMQKRVVIERKDNK
Ga0209136_10045128F015039GGAGGMAGADNTKTVYVTVALEVLRDADVHDIMSECDYSFEHSDIVDTELMGETEYA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.