NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208546_1000092

Scaffold Ga0208546_1000092


Overview

Basic Information
Taxon OID3300025585 Open in IMG/M
Scaffold IDGa0208546_1000092 Open in IMG/M
Source Dataset NameAqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)40411
Total Scaffold Genes59 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (84.75%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Delaware Bay
CoordinatesLat. (o)39.283Long. (o)-75.3633Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002827Metagenome / Metatranscriptome527Y
F005146Metagenome / Metatranscriptome410Y
F016263Metagenome / Metatranscriptome248Y
F036606Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0208546_100009213F005146AGGAGMKLTNFYEVMDFKGDIAWGGASALEAVEWFRRGLNSSVFVSVWNEEDIEEPRLVIDKIEISSVIRAAIALEHDRTFGVSLR
Ga0208546_100009215F002827GGAGGVNKEYYQAKADLCRDLAIKQMVEGDSKEAGANLIRMVRALTELELINYKEEKKNA
Ga0208546_100009216F016263GAGGMPKCGVCGWNFSDRTLTKHAETACGLDEEKAGRVAYSPEVDDLIKEMEEASE
Ga0208546_100009236F036606AGGAGMPANDPAQYEMEEDFLPWPSDTNDKPFMTYDKLMSGAMGKPAPKQGN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.