Basic Information | |
---|---|
Taxon OID | 3300025527 Open in IMG/M |
Scaffold ID | Ga0208714_1097724 Open in IMG/M |
Source Dataset Name | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 582 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Barrow Environmental Observatory site, Barrow, Alaska | |||||||
Coordinates | Lat. (o) | 71.2999 | Long. (o) | -156.61 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014641 | Metagenome / Metatranscriptome | 261 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208714_10977242 | F014641 | GGAG | MIIENVVRQNVYEQILKTANKRLEQAIPGSEGSYAHLSLGRVLNLLFFLKGEWGTIGDFWTTHQTLRAVVGDDLLWADPQKSSPAPAELVQ |
⦗Top⦘ |