NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208875_1009427

Scaffold Ga0208875_1009427


Overview

Basic Information
Taxon OID3300025410 Open in IMG/M
Scaffold IDGa0208875_1009427 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1794
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010669Metagenome / Metatranscriptome300Y
F012769Metagenome / Metatranscriptome277N
F014232Metagenome / Metatranscriptome264N

Sequences

Protein IDFamilyRBSSequence
Ga0208875_10094272F014232N/AMSQEKSKIVDEATTKEDTLEGSSHKSHECTCTPSAEYEKATEIGSLTNLIRLVYSIPLVNGLISYKPLERIWNSKKVIRRIDPGWILAGKVTLLEHQVLNQIDTIDISVPWDDVENKSRYLDLYKTIIKLKAIHPNWEMYLEDSKNHHFCKCLQCSEVKRRYQEMLDATSSEESNSEDEICSSNILSLK
Ga0208875_10094273F012769AGAAGMQFQYPKFKVKELVKDKFDPILEEEYQEETAMKVFKASIEVIRQSGNKLTEQHYLPYSPEEKEVVIKEVIVQISEWKNRILNRRQKEKITRIDRALSKKILDMLAEYLRALEETDIAKRQSKLYHTDAVAAITELQVNRKFASPERKPVKRKIH
Ga0208875_10094274F010669N/AMELESTRMEQSEDDLTDPSDSEDSNMGISETHWPSDPSEVKCRLHAYISHEQEILAELLSELESEVQTSSENNIVERIKKCFRCIDDIIEYATQFLKQARLIEMRNFTGFYYEMEKDAKQANRQALAILSILRRGNLSRLASSVKELVIELDDIRILVSRKTLEQIEETLEEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.