NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208109_1011587

Scaffold Ga0208109_1011587


Overview

Basic Information
Taxon OID3300025395 Open in IMG/M
Scaffold IDGa0208109_1011587 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Bioenergy Institute (JBEI), DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1370
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Crystal Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameCrystal Bog, Wisconsin, USA
CoordinatesLat. (o)46.0072Long. (o)-89.6063Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011367Metagenome / Metatranscriptome291Y
F022358Metagenome / Metatranscriptome214N
F030412Metagenome / Metatranscriptome185N

Sequences

Protein IDFamilyRBSSequence
Ga0208109_10115871F030412N/ACEKSAIGFNQPKGEQLTPIGLWNRRDNLVRELIESLNLMTVTVSRTIGTELQEHLIMRDLIKRIREIDDEWHLIVAPQGDNCLRIMHYDCHCNYNCRCDCRSRKDLHQNEKSTKN
Ga0208109_10115872F022358N/AMKNPPKTKIELINLEESDEDPFDLVMKCLDESSDSEDYDEDYGEGTSRGIPMFTEASEIISRAHSFIAHEQETLDEKLDEIIYEFEGSTENDVLQYLRKCFEIIDDSITWANQFLDQAIEKQIDSFTGFYYEMHDDAEIAITKTLTIISLLEEKNSFSLIPVVEDLTSEIDQIKVLVSNTTLEQVEETLKNYASKRSLNRRKIEDF
Ga0208109_10115873F011367N/AMEESKNLEVKEIDSHWSKEPSESESRCHNSISHELEILDRILSEMISNIGNSSEDTILLKLRECLGCISGIIIHASQFIDQTQAVEREYPIGINSLQEGIRINMTKTLTITSKLRERNLLQLLPLVKDLTLDLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.