NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207697_10154480

Scaffold Ga0207697_10154480


Overview

Basic Information
Taxon OID3300025315 Open in IMG/M
Scaffold IDGa0207697_10154480 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)999
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere → Corn, Switchgrass And Miscanthus Rhizosphere Microbial Communities From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3948Long. (o)-85.3738Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033852Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0207697_101544802F033852N/ASLGTIINESDTSVRIDGPNRRGVEFNLEGGAGIQRDRSSLLAEGTWRFSPNHRVGFQSFSTRRHAEKTIEQDLVIKDQTVPAGTRLDTSANTDFLIVNYQYSLIRDDRIELAAMAGLYGARFKFGFNSSTPPRDISSSTTAPLPMFGISLDTFITPRWTVSTFFEGLLLKVGDVKGSISYLGMSTDYMLTRHFGVGLGISAVKLGVDATKNDFTGSFDWRSQSFFGYVQARF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.