| Basic Information | |
|---|---|
| Taxon OID | 3300025280 Open in IMG/M |
| Scaffold ID | Ga0208449_1061018 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 978 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 39.48 | Long. (o) | 7.31 | Alt. (m) | Depth (m) | 2520 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026403 | Metagenome / Metatranscriptome | 198 | Y |
| F035486 | Metagenome / Metatranscriptome | 172 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208449_10610181 | F026403 | N/A | MKASTSYGLKRLVKKAQNLERIVEFDLVKKGTTRIETYKNRCLGYIERLGMLTNVSKEDKEVAARKMYKVYFNLQDYEGAEKESDMEVSLEALLPELDMAIVESYSADVRSGGLGFSSTHGLMLAEGLSAPKNPYWSVENSVKTQAPIRDTNYVYKPKQDVVQWREEMKQQKAEVLRATKMQ |
| Ga0208449_10610182 | F035486 | GGAGG | VLQRCSDPNCNRYATIYHPAPYCDRDWARRHSTQYAPDVAEELKLPTPSVPYRRYLEWQLKNRGLSKQPNETREEQFERCKARARKSKLLSS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |