| Basic Information | |
|---|---|
| Taxon OID | 3300025251 Open in IMG/M |
| Scaffold ID | Ga0208182_1003953 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5214 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mediterranean Sea | |||||||
| Coordinates | Lat. (o) | 43.29 | Long. (o) | 8.1 | Alt. (m) | Depth (m) | 2535 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003219 | Metagenome / Metatranscriptome | 500 | Y |
| F032828 | Metagenome / Metatranscriptome | 179 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0208182_10039532 | F032828 | GGA | MRMDLNKAGVLHLDLFDVETQEEQDQFIYYYLGLSGPVKKKFENAFYKAYVKRLLPEPEVKIIHTDVNNVTHIEVHPNDILKNLKIIKQIMSGDSIVEDENE |
| Ga0208182_10039533 | F003219 | AGG | MQEQNSEHPVIIPHIEEDIALPKNAREALPDMSPEEELSMRSNTVKLISDLAGQNIEPSQDNMEQAEEVAKEMMVNPELKPDFDTYPNETIAYLAGMVAQTSHMVTKDLANIKLTVLNGLLQEATLAKTSKERIAAFKAVGEIDGVDAFKRKTEVTHITKSGEELERELLKTIEELRGKVINVPHEVVDVTDIEVDDD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |