NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208031_1000580

Scaffold Ga0208031_1000580


Overview

Basic Information
Taxon OID3300025237 Open in IMG/M
Scaffold IDGa0208031_1000580 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6582
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameOrkney Island (southeast)
CoordinatesLat. (o)-61.27Long. (o)-43.92Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016738Metagenome / Metatranscriptome245Y
F045378Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0208031_100058013F016738AGGAGLKNYLAEPKPVSPYKDLINDYEGSVTKAAHGESGGLDHIIKSQLNPTARKKYNKERNAE
Ga0208031_10005807F045378GGAGMNSLNHCHVTSQVNAHTTAWDMPEITSDELTTEIVAELLTHGCVTINREEYHVMDLYQYADEEALNNLVYMTIRDPAAAKDHATQIITDCAIYYFGESNPGLAVQYLEEYYGEY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.