NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209320_10045851

Scaffold Ga0209320_10045851


Overview

Basic Information
Taxon OID3300025155 Open in IMG/M
Scaffold IDGa0209320_10045851 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado, USA - sediment 13ft 4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2082
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium LW23(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013593Metagenome / Metatranscriptome270Y
F041659Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0209320_100458513F041659GGAGGMSSDKHFLDEQGMTELARKSIEVLRQEGASPMELRRLEALLKEGNVGEAFIMSSLLRTIIGEISPEASQKKLLLVYRGLEDICQSLVELSRNLFDIDAWQHYRDSGFDSFESYCEGALGIPATKIQGLMLVKDQRLPRPKKAGPGEFFAWLYKIVEILAPAKAS
Ga0209320_100458514F013593GGAMDINYSLETLTGKHGGLLEVVESIISDGRLILILTDEDVLQRRDAPLKGVFYRVILPLAPATMNVKGEAFGLIRESLKFTEDGVSLEKLAREIGR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.