NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208157_1011552

Scaffold Ga0208157_1011552


Overview

Basic Information
Taxon OID3300025086 Open in IMG/M
Scaffold IDGa0208157_1011552 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2905
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-12.999Long. (o)-80.801Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F005313Metagenome / Metatranscriptome405Y
F013703Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0208157_10115524F005313GGAGVIKLELSGGNQTITKVCNHCGCHIENLQVEDILVKPKWANSDNMTFRDKDGNEITRTELPEELKDCKCEHC
Ga0208157_10115526F001319AGGAGMKKLWSIILLIGLVNAQMPEPTMVGQDKLQVPTLSINNFVNQAEIEGLEDTRVFLGITNILTENVMDSRYDLVEQDSDFELTARIIYLGRPRTATTFLGLFRRETTTTEVRVVVELLNKKTGQVVSGNGIGTIDKEISSTGFQINEELPFDRSELGGALKEAIGNAVQEIL
Ga0208157_10115527F013703N/AIPFRGNQINLQTFVSYTFFRYYEGLKTENKYLLLESPILIYPGASIDINFTETFKMNFGFYVGYNTLVNDIGDRNISYSIVFGTNF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.