NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208298_1000975

Scaffold Ga0208298_1000975


Overview

Basic Information
Taxon OID3300025084 Open in IMG/M
Scaffold IDGa0208298_1000975 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11060
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (17.39%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003058Metagenome / Metatranscriptome510Y
F003647Metagenome / Metatranscriptome475Y
F005817Metagenome / Metatranscriptome389N

Sequences

Protein IDFamilyRBSSequence
Ga0208298_100097516F003058N/AMSKLADIIVDKIIERQRAYDDEFKADIQSMVDENTNIEFGTITQDELIIEEIDGLQETLDRLETEENYEAARIVANKIKHLKNKYKL
Ga0208298_100097520F003647N/AMAMCEWTLADIKNRASNKAFAKVTILTLDVETYKEDLRTGNIGGVTYEEFEQVVKGYETELKIWNYITELIEKQ
Ga0208298_100097521F005817N/AMRSNLLSRLKPEFKKGLEDNKLRYPSMTNDIEFLLTQLFYYDDLTLRQVLNIFVFSDMEYLDRKSFDWRYGEDVFEVENNVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.