Basic Information | |
---|---|
Taxon OID | 3300025079 Open in IMG/M |
Scaffold ID | Ga0207890_1006106 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2738 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (10.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Pacific Ocean | |||||||
Coordinates | Lat. (o) | 50.0005 | Long. (o) | -144.9964 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F017499 | Metagenome / Metatranscriptome | 240 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207890_10061067 | F017499 | AGTAG | MSGVTKDNLYVDLNWGFDHVLGYWYDIIETKNGEETIIEDWSSKTHGGSRSKMLEFLIKYNCPEEHRRMVALDMKF |
⦗Top⦘ |