NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209615_100607

Scaffold Ga0209615_100607


Overview

Basic Information
Taxon OID3300025075 Open in IMG/M
Scaffold IDGa0209615_100607 Open in IMG/M
Source Dataset NameFreshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3123
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameUSA: Indian Creek, Illinois
CoordinatesLat. (o)41.6655Long. (o)-87.5437Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002009Metagenome / Metatranscriptome604Y
F007747Metagenome / Metatranscriptome345Y
F031024Metagenome / Metatranscriptome183N
F082339Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0209615_1006071F082339N/AGEGGQFNDMPDWLQEKIRASKEFATAAGKSTATKVEVDADGNQVPF
Ga0209615_1006074F002009AGGAMTAPTIQEMGLAAQEIVWRVMGKGSDKSGYGDWLLKDRPTHDYHIARAIRHLATAQMQLHKSSPCPDNNGETSVDHLERALVRSLFVLAQIKKEVTRL
Ga0209615_1006077F007747GGAMKIGTIKFGKSRPAPKAVIVDVSYDKETEATLFKIGLDLLKKDKEAVIEYVIQKSLAYQLKK
Ga0209615_1006078F031024N/AMKQALVTQSFGDEWKNIIDLTRPRMEAYCKRHSTDFILIDKPLTHPAQYSKSAIGNIMATKGYDQVTFVDADVLIAADCPKLSDDAGVFCAFDEGAYLDRKPDMVKLAGAFGGVIEPKFYVNTGVFVVHTKAVGVLSMPPIG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.