NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208667_1007072

Scaffold Ga0208667_1007072


Overview

Basic Information
Taxon OID3300025070 Open in IMG/M
Scaffold IDGa0208667_1007072 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2834
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.21Long. (o)-77.52Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004606Metagenome / Metatranscriptome431Y
F042621Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0208667_10070722F004606GGAMKAHRIFTKGQTVYCLLSSFSKPNVLLPIKGLIVDTQWDPINPLYQIRIIKMYDNMKYLKTHFFDMNFKYEFNNRARKMPIKKEDFKNVKSLEDRFDESDRERLYVIVESVMCKKTKNDLQGLFEKVQFYIISKNLKEIRDISSRPFFKGSLSTDSSQEFNVRFKRGWVDKFQNGDIDIDKYLDSLG
Ga0208667_10070726F042621GGAMKNTEEKKLQWIKGDKLGTVESIKDTEGTWTTFHSGNRIATNLISEFLEPLDGEPLEFDPPAPALIKAAEVYKEKVPTQEAASSPIRTLFDKQKKNDKVKLNLTFPIEVPKKAIYEIISSSFDSNEVNDELESFIKDQISEDLILNSLFESIKELISTRYKID

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.