NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207905_1040174

Scaffold Ga0207905_1040174


Overview

Basic Information
Taxon OID3300025048 Open in IMG/M
Scaffold IDGa0207905_1040174 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)739
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0003Long. (o)-144.9998Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003020Metagenome / Metatranscriptome513Y
F004988Metagenome / Metatranscriptome416Y

Sequences

Protein IDFamilyRBSSequence
Ga0207905_10401741F003020AGGAGMPDISRFKSVSVSVDTHNQLEALAKKRFEVPVSIQKVIEFMLTKETKQKNAKAR
Ga0207905_10401742F004988N/AMPKLVEAICPRCDGNGYIKVEKKEVNCPMCEEPFSYMGKEISTNNGYVMLPEEQTRINVEGGRESKMKWSGETLPEVQK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.