NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207905_1028993

Scaffold Ga0207905_1028993


Overview

Basic Information
Taxon OID3300025048 Open in IMG/M
Scaffold IDGa0207905_1028993 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)902
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0003Long. (o)-144.9998Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019574Metagenome229N

Sequences

Protein IDFamilyRBSSequence
Ga0207905_10289932F019574AGGAMKYKNVLGKDFKRKEDAYKHFQLLRNKTPLGKILDEKTAITKNAMDELFKNYFLCNDEDWYQRKIGPGVLNWSFGYDSQGGICLWVHQKDKPKVKECKFDVSHWGEKVPVAAKWMFTCFGTGVLMNENKMHRVKQAARKAVEIHKKQFREQVEPICNKCGIEIHGLDAEVDHKDPTFMTLFNNFIKENNYDEEYLLKSVNKHNNEDIWYFINTGMKESWIEHHLHNSYLQLLCVTC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.