| Basic Information | |
|---|---|
| Taxon OID | 3300024350 Open in IMG/M |
| Scaffold ID | Ga0255167_1013337 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1653 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 31.4271 | Long. (o) | -81.6053 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001229 | Metagenome / Metatranscriptome | 741 | Y |
| F005586 | Metagenome / Metatranscriptome | 395 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255167_10133371 | F005586 | GGAGG | MTANFKLDAMLELRKFLWNELKTRNIFDEDDYWSDNLNENIIPIVPVQQTAEMNQFLSGKKHIVYDKIGMSYEDNWMICCEQILFTIYSTDFSEINEIRNFMTDQF |
| Ga0255167_10133373 | F001229 | GAG | MNDLIDSVLSMKLDVYRQSEIQDADTGAIKREWNYHRTVDCHAKGVISNSATTRSSDKQVFSNKYMNDQIIQVRTSEKLIMREKVTNIRDAHDNVIWAEINFPTETPTVFEVVGTTPITDPFGTVLGYNSSMKRSENQQIGL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |