NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244776_10372661

Scaffold Ga0244776_10372661


Overview

Basic Information
Taxon OID3300024348 Open in IMG/M
Scaffold IDGa0244776_10372661 Open in IMG/M
Source Dataset Name0.2um to 3um size fraction coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)954
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001754Metagenome / Metatranscriptome641Y
F003291Metagenome / Metatranscriptome495Y
F007113Metagenome / Metatranscriptome357Y

Sequences

Protein IDFamilyRBSSequence
Ga0244776_103726611F001754N/AWLKAWKCGKDHLSLCSKRVGKMPPHKNKNYNMNTVYNNFAASKMSNNPKFEVIVSFTDFLGKTHNIVCKSRPKLKEANEFLKMFKSETVRINSILSEYPVVLGKFPKKYHSEIKRELASAGFSTVSNFLIGK
Ga0244776_103726612F003291N/AMNTNQMNEKLVSVFTQDELAALMTAMAGYVNVKRKQGRSTGIECMVFNKVTDALLLSNYLNAEVIDTKPNSNAPMGSAAYKAYEAMYDSDVRAHS
Ga0244776_103726613F007113N/AMKIRLELTPEQLKTVEIALNELFNSDRWISGRKEADIDKISVGAAYLLHVIESYNKRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.