NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244777_10022378

Scaffold Ga0244777_10022378


Overview

Basic Information
Taxon OID3300024343 Open in IMG/M
Scaffold IDGa0244777_10022378 Open in IMG/M
Source Dataset NameCombined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3998
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (85.71%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005531Metagenome / Metatranscriptome397Y
F014142Metagenome / Metatranscriptome265Y
F063685Metagenome / Metatranscriptome129Y
F080046Metagenome / Metatranscriptome115Y
F103145Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0244777_100223783F014142AGGAMNSLNTLTVVTEPSHPMASSNTKSNELFRLANGNYISRMAYVHMVASEGLISHRYLTPNESKWVFANRVA
Ga0244777_100223784F005531AGAAGMTITYTLWQGSQLLAVNQKASKPEEILAVVAELNKLGKGFTYNIREVDTK
Ga0244777_100223785F063685GAGGMTIELDNYGFMLDTEWCYIALSWQLLITTALLAVGYKYYKKWKTKNVK
Ga0244777_100223788F103145AGGAGMLSENTLNKIVFEYQHGGVKNFHPEISFAERKALLKYLFSIPTHKDCECAK
Ga0244777_100223789F080046GAGMSLTLANKIAKDKFFQPPSKYINHKVVEIVSLNEDSSIATVILEKYTIGRNANVYKNNNVFTIELPYSEFQNLNGWSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.