| Basic Information | |
|---|---|
| Taxon OID | 3300024343 Open in IMG/M |
| Scaffold ID | Ga0244777_10000789 Open in IMG/M |
| Source Dataset Name | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 23995 |
| Total Scaffold Genes | 47 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 37 (78.72%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River Estuary, USA | |||||||
| Coordinates | Lat. (o) | 46.234 | Long. (o) | -123.9135 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014843 | Metagenome / Metatranscriptome | 259 | Y |
| F019092 | Metagenome / Metatranscriptome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0244777_1000078925 | F019092 | AGGAG | MSNVPILGEKKMDNEPMFRLLYCLVCESLDELPPYNGDPEQDHLLAIACESHVFPSGEPHKGKLFVLPLRAWAKTESKKEIVRQIKGGGSKGLAEVDDTFYDSRSMFLDDAMKCYQQHNKPKDGCNDWQIKEKLLIPNTAKERKAEGMGRYQDEAGPKTYLCNFCPVSIAVNQRKQKLLGLN |
| Ga0244777_1000078928 | F014843 | AGG | MNILVSLDGVLSSDSGEPIRAGVALYYALNINNRVAIMTSRKEADAKQWLQSHGIINYDDLIDSSFELAGEDLKKRQFVVSRSRAPIEMYVDADPTMCAWVFEEQRVPAILFSHPNFAAVENRPDAPSKVRRWSDIEKAITKVNIARSEQATRPKDTVAELWSD |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |