| Basic Information | |
|---|---|
| Taxon OID | 3300024323 Open in IMG/M |
| Scaffold ID | Ga0247666_1019914 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1441 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indiana | |||||||
| Coordinates | Lat. (o) | 40.4449 | Long. (o) | -87.0297 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000696 | Metagenome / Metatranscriptome | 931 | Y |
| F006125 | Metagenome / Metatranscriptome | 381 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247666_10199141 | F006125 | GGAG | MPITITLLPSNEDGSGSNLFYAIGTLTFSGNYPTGGDTLDFTTVADKLPSTQIIQVFADSQNGN |
| Ga0247666_10199143 | F000696 | GGA | MPVVGSSAYNTAGQITSLVRSLLNDAQGNLFTDAVLLPYANSAYRKLQRALGNAGGGGFIQDDALLVVPAVAQADTSLQVSITDATAPPNQLPTDLLVPIKIWERPNGSSDDFLEMVDLTQHGGLPSRVQDVTLSVWEWRADGIYFLGATQDTQIRLRYAKAYPDFTDASSPVLVRNAQEAIAYATAALAGWARGSPLAEKWDDAAADAIEDLVSAAVRREQQSARRRRPFSSRSGYTPF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |