NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228660_1013932

Scaffold Ga0228660_1013932


Overview

Basic Information
Taxon OID3300024291 Open in IMG/M
Scaffold IDGa0228660_1013932 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 74D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1526
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001588Metagenome / Metatranscriptome667Y
F023086Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
Ga0228660_10139322F023086AGGAGMQNTNTQYTNAVTAAIQSFARTIANVAHDSVAEQNDYAIHDSLDSIQFLYSNYTKYDNVNCLANAALCSSLDTVVRENIYAQLV
Ga0228660_10139323F001588AGCAGVFENKQTHNYVFLAAENACIVVKVNNVTVATDVQTADALIQVFLQHNINCVTDTIMCSSSIDFAAEENFATDVCAHNIIDAALDVLAPVQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.