NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210003_1030517

Scaffold Ga0210003_1030517


Overview

Basic Information
Taxon OID3300024262 Open in IMG/M
Scaffold IDGa0210003_1030517 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3026
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)58.622Long. (o)18.254Alt. (m)Depth (m)437
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008071Metagenome339Y
F012953Metagenome / Metatranscriptome275Y

Sequences

Protein IDFamilyRBSSequence
Ga0210003_10305172F008071GAGGMTAAEYVEASGVPESRWPNFRQWFDWYERNNLVGVVKDGQEVVGVAVARAVDGSQEITHYVHKPDAPDAYVDLTVTSIDGTSTPHSRLAMKRLLSILWDELGPRRSLIFNRNGTKKVYDYMNFMRKVGV
Ga0210003_10305174F012953N/AVAYNDSELQAMDLATIVSQDANLLDEDTTGTPAFYYFKGRNTGGTAELDLYPKLETTSTNTLLVVQKLQCLTRTNLVVDFPPSASSIVDELRLPHVSHVVLALTHADALERERQYGKAQVVTQAANADLASMANYELSQVGGMKQITPVGLGDLGIEEII
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.