NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247672_1032868

Scaffold Ga0247672_1032868


Overview

Basic Information
Taxon OID3300024187 Open in IMG/M
Scaffold IDGa0247672_1032868 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)843
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055807Metagenome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0247672_10328681F055807N/ADLRVPESPAVGADADTTVARSIDPLPSLMAPPAPRDLTRVETRWRPFLGFVGNSWGAIGEVRIEHYFKKPFMLGVELSPVAFASSGDGVGAATHVRAVGALVTKHLSLGLGVGAKVQRYGSSGMSVAPSVRLGSIDGLNLYLTYTHAIAPNKYTNKLTTGFSNALARLQVPVTRGLALELDAGVSLDTWGFATLGLRQRVFGNGGPGTLYISGGFGLAMVVDKSPCNYNNTYPCGSSATSYGPTVSAGLEYRF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.