Basic Information | |
---|---|
Taxon OID | 3300024183 Open in IMG/M |
Scaffold ID | Ga0228603_1014707 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Monterey Bay, California, United States - 3D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1046 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 36.8313 | Long. (o) | -121.9047 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025990 | Metagenome / Metatranscriptome | 199 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0228603_10147073 | F025990 | GGAG | VKDEHPAYRAKFYIPELKKYTNWSDYLVYYKEQDDKIMLFSNYCMQMWSSYMSNKIKKEKAPLSYKEYLNKYKQLLEDGYSDRYKN |
⦗Top⦘ |