NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214919_10085648

Scaffold Ga0214919_10085648


Overview

Basic Information
Taxon OID3300023184 Open in IMG/M
Scaffold IDGa0214919_10085648 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2758
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004451Metagenome / Metatranscriptome437N
F008079Metagenome / Metatranscriptome339Y
F018483Metagenome / Metatranscriptome235N

Sequences

Protein IDFamilyRBSSequence
Ga0214919_100856482F018483AGGAMMCEAVEAYIYSKKGVLVQINRIAIISDARQMEMLVYAYAYANGDR
Ga0214919_100856485F008079N/AMKIKDEFIGVKVSHKGNNVNVSTENYTFCESIGLGYMFEEPTVSEPKVIKYKAVKGPIPEPAVESEDNGTEAE
Ga0214919_100856486F004451N/ALRISSNGMRPILDNYISAHYKEIRKYTNYFLVRMMSTISADAVINNSFLYLCNIDIEVTDPAKVKAYLLNTIKMQILWSTSLTNRQERVTATDSTMPIVMDDNTDLWDKIRDDMQYQNNMAVIETYRGRITDRIKLIVFQCYFDKGYSTARAMAEYFKIPVTSAHYWIQEIKNDLKQLRDEN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.