NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10316545

Scaffold Ga0214921_10316545


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10316545 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)856
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000441Metagenome / Metatranscriptome1136Y
F001781Metagenome / Metatranscriptome635Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_103165451F000441AGGAGGMKMSDAYLNDQLNTAQKLLWGGSETENIEAHNIIAKLIKDRIEQTN
Ga0214921_103165452F001781GGAGMKPSDKKKLNKCLDILGTTDLGLSLVWLWTWSTIKGLMEDNGGDWVMVATEDEMWDHLCEAVEAGMGFSLEYGAEQHYEDVQDWMLSRGYMTDPFDEEEEDKDEDE
Ga0214921_103165453F000263AGGMNSEDIGLPPHLQRLVNAGVSGLDIMHGELKNLMLIAEQELADAIEREEESGEAMDSMVRTECEGHLDALVALYELTYQLSFAIGARDEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.