| Basic Information | |
|---|---|
| Taxon OID | 3300023174 Open in IMG/M |
| Scaffold ID | Ga0214921_10277219 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 956 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 34.2611 | Long. (o) | -83.95 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015995 | Metagenome | 250 | Y |
| F042868 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214921_102772191 | F015995 | AGGAG | MPVEVVGVKDVLKGLEFIDEDMRQRIRTAIDPLMRGVAFKAKGFVKGNDDVLSGWAKASGNPGTFPKYDAGVVRSSIGYNPGENKTFKNGFKVSNYVYNASRPGAIYEVAGRLNPQGRAPFEFRTSKGEGGTYTKKSARSRALQQYNSSNPFASQQFVAALEPVTAQPKIKDIRAGGRKTKGRLIYKAWAEDSTKVYDAILKAINLTAIDFNKKTEIKKAA |
| Ga0214921_102772192 | F042868 | N/A | VLREHERQTEIFWLAYECLRRAGAQIPIWGTEFIDTLETVEVLDEEKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |