NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10052679

Scaffold Ga0214921_10052679


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10052679 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3553
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (88.89%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000852Metagenome / Metatranscriptome860Y
F000868Metagenome / Metatranscriptome853Y
F033433Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_100526792F000852AGGAMTTKREYLKQQGITVGVRGRFSGAAKVAIQEALNKGITFTDEKTAKAK
Ga0214921_100526794F033433AGGAGMNDISLEILEVNYSCSPGGVDEFEVYSLDTRDHSLPPIFSSTKLEEAVRFCYELGKDFTVRTFAQWQERELA
Ga0214921_100526798F000868AGGTGGMSFLENENQMVIDATYQEIGEMLVEDWVNSNLDEGQLFADYRFAEMCESNYLKGRFNQFYDLKPEDQYYIEWDEEA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.