| Basic Information | |
|---|---|
| Taxon OID | 3300023174 Open in IMG/M |
| Scaffold ID | Ga0214921_10041095 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4267 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 34.2611 | Long. (o) | -83.95 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041650 | Metagenome | 159 | N |
| F091376 | Metagenome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214921_100410952 | F091376 | AGGAG | MKYAQWTIKRPEGSTPEPLIRSRGGQASGGFMKDADTVIGYVWNDVDLTGLEKWNFSTMTNLEAMAIAQAMNAECFFGDDGTIQAPQPEL |
| Ga0214921_100410953 | F041650 | N/A | MREDIQLSFIECQMPRTPYQLERFVVGQHDTPEMQFVQVCRELEALYYTIKEVGMANKKTELEIAKLRATGDEIDAIDADIKELGLERTRLVAIGARRELDELIKMYDAMPHFTRQQIDESQPDYWQARLGRQANLQMMAGGAGWAHLEALDQIGVLQPMIQAQQEKTKELE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |