NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10001223

Scaffold Ga0214921_10001223


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10001223 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)44427
Total Scaffold Genes47 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (91.49%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000340Metagenome / Metatranscriptome1267Y
F008879Metagenome / Metatranscriptome326Y
F046255Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_1000122316F000340GGAGMNWSDALKAVIPIVVMSLAWLLGQVNSFSERLTKIEGQMPALITKEGVPTDSPISAERRAILKEGLMQHINELQVKVRLLEEREKLGKKP
Ga0214921_1000122317F046255GGAGMNDQKIALTLPLLNAVLQYLGTKPYQETAQLIQAIQEQAIPQMPMPEAAQPASTAE
Ga0214921_1000122322F008879AGGAGMATTFKKGEVVKLSAVVPQGPVIALRMDENGVVQYLVEWEDATGVEHQRWFDEDQLTGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.