NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224558_1000400

Scaffold Ga0224558_1000400


Overview

Basic Information
Taxon OID3300023090 Open in IMG/M
Scaffold IDGa0224558_1000400 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)51348
Total Scaffold Genes51 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)47 (92.16%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032901Metagenome / Metatranscriptome178Y
F061456Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
Ga0224558_100040046F032901AGGCGGMMTFLKEKSADALQIALRAARENEARWMEMSPEISADCDRMEQWASTAKLRRLEIERIETILAEVENSSPGPTLR
Ga0224558_10004005F061456AGGAMTCSAFPPVSLTPFSADEPAPRKSYFPQAIAELTAASLASKPAETDDGAALLFMHGGAWVRWAQMPASIPAKNNA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.