| Basic Information | |
|---|---|
| Taxon OID | 3300022752 Open in IMG/M |
| Scaffold ID | Ga0214917_10046280 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3005 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (14.29%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 34.2611 | Long. (o) | -83.95 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F016038 | Metagenome / Metatranscriptome | 250 | Y |
| F052418 | Metagenome | 142 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214917_100462804 | F016038 | N/A | MPQDIDLLPTQKSLIDLSELPKNSFNSVFFGYNLKQVLDDVLLVKFVDETEDGVNIVRNGIVVPINTDTKAWRFGEIVLCGPSVKYTKVGDIVCFPNNLGVPVANLEVDSYGTLKKGIFLNEQRIFGICSVRKDNESVAANIKKTTSKQRSRN |
| Ga0214917_100462805 | F052418 | N/A | MKVLLPTLKKLLLSNVAEIKFVRRRPKAGSPPTRRMLCTSSLSLLNSPEGRIALNYRRAINYPKFDPNVKDLLITWDIFMQDYRCINMKACDLVSVIPANKAFWKYFNDKLALLSANDKIRFMNS |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |