NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212088_10011497

Scaffold Ga0212088_10011497


Overview

Basic Information
Taxon OID3300022555 Open in IMG/M
Scaffold IDGa0212088_10011497 Open in IMG/M
Source Dataset NameAlinen_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13814
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (48.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameFinland: Lake Alinen Mustajarvi
CoordinatesLat. (o)61.5637Long. (o)22.044Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015815Metagenome / Metatranscriptome252Y
F042305Metagenome / Metatranscriptome158Y
F079857Metagenome / Metatranscriptome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0212088_1001149712F042305N/AMTLELSDLDTIKNSALERFEERVGSAGDNPEKIEREAFRLESQLEQLYSLTAVMARREPEVAGTAQLWGSLVRTCDLFAGKIFQLSQQYSLGRAAYDHILDIRTAAEELRALHSP
Ga0212088_100114974F079857AGGMTTLEAQWSPAKLLILGDDPQLRVYAEVSVWYKKIEMFRQGEDQRMFVQEPTSEDLAVHRSLLCRLIVDGEHLIRLIDQVGLPENLEAITPQSVAASLEVICADYRGWHEPMPAAQRERILQQVFTEVA
Ga0212088_100114978F015815N/AMGDPFWTPRTLAKAEMEWEITAVKTLTVDDQKRIRIPDAKPRQVFAYANNGDGTLTLTLVKAEAREPFPRGSLLKYFTPEKDKEELPLLSGCSLDQN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.