NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181353_1010065

Scaffold Ga0181353_1010065


Overview

Basic Information
Taxon OID3300022179 Open in IMG/M
Scaffold IDGa0181353_1010065 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2363
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004762Metagenome / Metatranscriptome424Y
F009886Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0181353_10100653F004762AGGMATSAEVLAMLIPNGGYTQIGEAYEGITFIEAEPISKAEWEAGFPIYDAWKAQKDADEAAAKAAAEAKLEALGLTAEDLAALGL
Ga0181353_10100655F009886N/ARYGYVNLDGNHAVGPALSIVKRSGDVRNSITLGYGVGSAEVTDEDLESIELYGELATSIKTTLRHSADAADQAAFYLEIRAYPQYAFRQITFPIGNPEIDDTDRDALLSVFMGMPLNIENLPNNMVYGRFQGFVEGWTWTAGLNNLSLTINLSPLAFSLQAYRWELVGVLETWNTISPTLDWLEATIVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.