| Basic Information | |
|---|---|
| Taxon OID | 3300022179 Open in IMG/M |
| Scaffold ID | Ga0181353_1000057 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21626 |
| Total Scaffold Genes | 37 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 32 (86.49%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.2382 | Long. (o) | -86.2805 | Alt. (m) | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000220 | Metagenome / Metatranscriptome | 1544 | Y |
| F042750 | Metagenome / Metatranscriptome | 157 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181353_100005717 | F042750 | AGGAGG | VIKGHTGDCAVMEEGPCTCGTDEILEELALEDAGLTAEDFE |
| Ga0181353_10000573 | F000220 | N/A | MPNEKPNPDDTLSKVLAYVDSPFKLIAILVMGLVTFTGYFLWQNQELLVGAYRENQKMPSIAEDRIEDAASHLFKHTGAVVVAVFKVNPMFGTRVLHRAYTKEGRDKINDGLDIGLFTSNAANNKDVVALMAGEITCGSYTQAQSEIGLWYIEKGMTFGCRVGVPPDPSRFIGQITVGWAEQPEDMEKINNLLLIAATMLSRSKQ |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |