NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222712_10041013

Scaffold Ga0222712_10041013


Overview

Basic Information
Taxon OID3300021963 Open in IMG/M
Scaffold IDGa0222712_10041013 Open in IMG/M
Source Dataset NameEstuarine water microbial communities from San Francisco Bay, California, United States - C33_657D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3539
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water → Estuarine Microbial Communities From The San Francisco Bay-Delta (Sfbd), California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.1516Long. (o)-121.6883Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002598Metagenome / Metatranscriptome544Y
F014129Metagenome / Metatranscriptome265Y
F045755Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0222712_1004101313F014129AGGTGGMTTLIREITLSNVSADEANLIVCVFCSDYANEIFCGNCNEYKGLMTLGEWLAYTQESWVM
Ga0222712_100410136F045755GGAGMNEISGMWICDNCDTLAVVSVLTDTIAIQQCKCVTNERENLNV
Ga0222712_100410139F002598AGAAGGMATKLYTIESLLVGKNYRSTNRHFSGEIISAEPRPEIWYGENTEAYLIEINAGGLRNKFATIAVKVGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.