NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213921_1007913

Scaffold Ga0213921_1007913


Overview

Basic Information
Taxon OID3300021952 Open in IMG/M
Scaffold IDGa0213921_1007913 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2046
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9266Long. (o)-83.4611Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000354Metagenome / Metatranscriptome1244Y
F004978Metagenome / Metatranscriptome416Y
F007689Metagenome / Metatranscriptome346Y

Sequences

Protein IDFamilyRBSSequence
Ga0213921_10079132F004978AGGAGMITADTLEILTTYSPQYLTRAAQNAGYKGAVFSSCKFLGITNGGQFAYQAVFPVKGGTDSTKVFLSYDHAEDRVFADVQLTDWA
Ga0213921_10079133F000354GGAGMSKVNYDNFSSFDLNECCDFFDSEKQSNWKKIGKFIVADGQEYNEVMLKDFDYDEVNEGEWEAFHAGVKYALTKMNIALDAADLPLEVAEVDLVESFGYMLVRTDDTPESFTKRVMKKPVVMVESWVD
Ga0213921_10079135F007689AGGAGMKLFEATIRQPDGKEFTDRVGADNAEEARRLLQQRHGPRAVPYMPRMIPS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.