Basic Information | |
---|---|
Taxon OID | 3300021791 Open in IMG/M |
Scaffold ID | Ga0226832_10193908 Open in IMG/M |
Source Dataset Name | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 791 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids → Characterization Of Microbial Community From Mariana Back Arc |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Daikoku vent field, Mariana back arc basin | |||||||
Coordinates | Lat. (o) | 21.3250983 | Long. (o) | 144.19162955 | Alt. (m) | Depth (m) | 409.13 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065212 | Metagenome | 128 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0226832_101939081 | F065212 | N/A | TITEKFHMNLLPQKNRSVKITEKEELFLQNLFQNGGSVMSAAMDAGYPKGSVGWLKNKLADEIIRRSKNLLATASVKATNKLIEMIDTPEVNRGDDLRLKAAESLLNRVGLGKEETHNHNVQALHGVVLLPAKKGMEINGQS |
⦗Top⦘ |