NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213863_10007126

Scaffold Ga0213863_10007126


Overview

Basic Information
Taxon OID3300021371 Open in IMG/M
Scaffold IDGa0213863_10007126 Open in IMG/M
Source Dataset NameCoastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7213
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Coastal Seawater Microbial Communities From Pivers Island, North Carolina, United States

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)34.7181Long. (o)-76.6707Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000751Metagenome / Metatranscriptome907Y
F006815Metagenome / Metatranscriptome364Y
F018560Metagenome / Metatranscriptome234Y

Sequences

Protein IDFamilyRBSSequence
Ga0213863_1000712611F006815N/AMGTNYSQETAQSIIEQYRFRVEALSNKIEELQAKIEVSQINKQNG
Ga0213863_100071262F000751N/AMNIYKTNFPTEQQGKDYLFNLGVLIDVDGEIVFSKNTAAVVNIGKIVDPTKTTDPENPVYYDGWAFDIMSSDQLDFGTYEVYPGDEAAHSFYGYPRGAEVPQ
Ga0213863_100071268F018560N/AMENVKCIKVRKDYYLLFIGDKSLGEFERSQLRHIIEVIDNAI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.