NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206688_10036068

Scaffold Ga0206688_10036068


Overview

Basic Information
Taxon OID3300021345 Open in IMG/M
Scaffold IDGa0206688_10036068 Open in IMG/M
Source Dataset NameMetatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1521
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056672Metagenome / Metatranscriptome137N
F069327Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0206688_100360683F056672AGGAGMKAQEYNLTGNEKFSVWFTTMMMMTNAQLDHDSKARILKMAKIMCVGECLDMQKLENKDPAEMKKSKEKQKELDAMKDAIWKEMDKITEVLTACYGEPRKGNKHHRCRHND
Ga0206688_100360685F069327GAGGVGRWDEREKTIDGDTPEEIIEDFEVAKVAVNCYQHKKEHFLIGLDLISEGKRIDEQLDFWELRLEKLCRENYRLLKSKRKDVDEIMDFFSEKIKDKMK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.