NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210396_10000899

Scaffold Ga0210396_10000899


Overview

Basic Information
Taxon OID3300021180 Open in IMG/M
Scaffold IDGa0210396_10000899 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)34371
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (78.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000072Metagenome / Metatranscriptome2651Y
F000540Metagenome / Metatranscriptome1043Y
F015632Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0210396_1000089920F000540N/AMAKKKAANALPKLAEVEQDLLSHIQNGYQLETDLLGSNPVLQRSKDNEEIRPLSANRNTIKALEQRGLISPDKGRDPLTIVWHLKKKQP
Ga0210396_1000089923F000072GGAMDVERIIDEIEQLQEMFEAPDIRPLRASDIAAANRRHDERQASNLWLRLWQQYGVCCRS
Ga0210396_1000089924F015632AGGAMRGLALSGLHPSSILLVSMLVLFTHVLRAQRTPPLEKSAVQLPDAPSRVATVWEAQTSFHFTYKGFPLSLRQHQGQTESWMRFFSDQAGYDRLSINTNTALNQDRGTVEFWSKNKGFMGSAPTRWMTLAPPFGHVHHETIHGANDLEYYGHHLPWAGSVILRVSQQARAHPHLTSVLKTVHPQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.